Help  Custom Search
 
ATP-dependent protease, ATP-binding subunit of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

ATP-dependent protease, ATP-binding subunit

Synonymous Names

CLPX_ACAM1, Caseinolytic peptidase X, ClpX.

Gene names

Gene Name

clpX

Gene Locus Tag

AM1_3450

Gene Identifier

5682258

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class II Clp Proteins
(ClpX-Caseinolytic peptidase X)

SEQUENCE INFORMATION

Sequence
MSKYDSHLKCSFCGKSQEQVRKLIAGPGVYICDECVDLCNEILDEELFDTASSMPAASRAPVAERKRSQS APLSLNQIPKPRDIKSYLDEHVIGQDEAKKVLSVAVYNHYKRLSISQASADSVAELDDAIELQKSNILLI GPTGCGKTLLAQTLAQMLDVPFAVADATTLTEAGYVGEDVENILLRLLQVADLDVEEAQRGIIYIDEIDK VARKSENPSITRDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQDCIQIDTTNILFICGGAFVGLDKII EQRTGKKAMGFIQDGELRAKEQRTADMLRDLEAEDLVKFGMIPEFTGRIPVMSVIDALDEDVLCQILTEP RNALVKQYQKLLRMDRVELEFQPDAIRAIAQEAYRRRTGARALRAIVEEIMLDVMYELPSQSRKELTQCL ITRSMVEQRSTAELLVHPSAISTPESA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGTCTAAATATGACTCCCATCTCAAATGTTCATTTTGTGGTAAATCTCAAGAACAGGTCCGCAAATTAATTGCTGGGCCGGGGGTCTA
TATCTGCGATGAATGCGTAGATTTGTGCAATGAAATTCTGGACGAAGAGCTATTCGATACGGCTAGTAGTATGCCTGCTGCCAGTAGAGC
CCCGGTGGCAGAGCGTAAACGGTCTCAATCTGCTCCCTTGTCTCTCAATCAGATTCCTAAACCACGGGATATCAAGTCATATTTAGATGA
ACATGTCATCGGACAAGACGAAGCGAAAAAAGTCTTGTCCGTTGCCGTATATAACCATTACAAGCGTTTGAGTATTAGCCAAGCTTCGGC
AGATTCTGTTGCTGAGTTGGATGATGCCATCGAATTACAAAAATCCAACATTTTGCTGATCGGTCCTACAGGATGTGGCAAAACGTTGCT
GGCTCAGACATTGGCTCAAATGCTCGATGTTCCGTTTGCGGTGGCAGATGCCACAACCTTGACAGAGGCTGGCTATGTAGGGGAAGACGT
CGAAAATATTCTATTGCGACTCCTCCAGGTTGCCGATTTGGATGTAGAGGAAGCCCAAAGAGGGATCATCTACATCGATGAAATTGATAA
GGTGGCTCGTAAGAGTGAGAATCCTTCGATTACGCGAGATGTGTCTGGCGAAGGGGTGCAGCAGGCTCTGTTAAAAATGCTGGAAGGGAC
AGTGGCTAATGTTCCTCCCCAAGGTGGGCGCAAGCACCCTTACCAAGACTGTATTCAAATCGATACCACTAACATTCTATTTATCTGTGG
TGGGGCGTTTGTCGGTCTCGATAAAATTATTGAGCAGCGGACGGGCAAAAAAGCCATGGGATTCATCCAAGATGGTGAACTCCGAGCAAA
AGAGCAGCGCACTGCCGATATGCTGAGAGATTTGGAAGCTGAAGATTTAGTCAAATTTGGGATGATTCCTGAATTTACTGGTCGGATTCC
GGTGATGTCTGTGATTGATGCTCTGGATGAAGATGTACTCTGTCAGATTCTGACGGAGCCACGCAATGCTTTGGTGAAGCAATATCAAAA
GCTATTGCGGATGGATCGGGTAGAGCTGGAGTTTCAGCCTGATGCGATTCGCGCCATTGCTCAGGAAGCCTATCGACGCAGGACGGGAGC
CAGGGCTCTGCGGGCTATTGTCGAAGAGATTATGCTGGATGTGATGTATGAGCTACCGTCCCAATCTCGTAAAGAGCTGACCCAATGCCT
GATTACTCGCTCGATGGTGGAACAGCGGTCGACGGCTGAGTTGTTGGTGCATCCTTCCGCCATCTCGACCCCAGAATCTGCATAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine35227 %
Guanine36027 %
Thyamine34826 %
Cytosine28422 %
A+T70053 %
G+C64448 %

Total Bases :   1344 bases

Microsatellites
SequencePosition LengthRepeats
TCTCTC21923
AAAAAA29423
TATATA31623
AAAAAA85523
GAGAGA92323

Microsatellite Map

ATGTCTAAATATGACTCCCATCTCAAATGTTCATTTTGTGGTAAATCTCAAGAACAGGTCCGCAAATTAATTGCTGGGCCGGGGGTCTAT
ATCTGCGATGAATGCGTAGATTTGTGCAATGAAATTCTGGACGAAGAGCTATTCGATACGGCTAGTAGTATGCCTGCTGCCAGTAGAGCC
CCGGTGGCAGAGCGTAAACGGTCTCAATCTGCTCCCTTGTCTCTCAATCAGATTCCTAAACCACGGGATATCAAGTCATATTTAGATGAA
CATGTCATCGGACAAGACGAAGCGAAAAAAGTCTTGTCCGTTGCCGTATATAACCATTACAAGCGTTTGAGTATTAGCCAAGCTTCGGCA
GATTCTGTTGCTGAGTTGGATGATGCCATCGAATTACAAAAATCCAACATTTTGCTGATCGGTCCTACAGGATGTGGCAAAACGTTGCTG
GCTCAGACATTGGCTCAAATGCTCGATGTTCCGTTTGCGGTGGCAGATGCCACAACCTTGACAGAGGCTGGCTATGTAGGGGAAGACGTC
GAAAATATTCTATTGCGACTCCTCCAGGTTGCCGATTTGGATGTAGAGGAAGCCCAAAGAGGGATCATCTACATCGATGAAATTGATAAG
GTGGCTCGTAAGAGTGAGAATCCTTCGATTACGCGAGATGTGTCTGGCGAAGGGGTGCAGCAGGCTCTGTTAAAAATGCTGGAAGGGACA
GTGGCTAATGTTCCTCCCCAAGGTGGGCGCAAGCACCCTTACCAAGACTGTATTCAAATCGATACCACTAACATTCTATTTATCTGTGGT
GGGGCGTTTGTCGGTCTCGATAAAATTATTGAGCAGCGGACGGGCAAAAAAGCCATGGGATTCATCCAAGATGGTGAACTCCGAGCAAAA
GAGCAGCGCACTGCCGATATGCTGAGAGATTTGGAAGCTGAAGATTTAGTCAAATTTGGGATGATTCCTGAATTTACTGGTCGGATTCCG
GTGATGTCTGTGATTGATGCTCTGGATGAAGATGTACTCTGTCAGATTCTGACGGAGCCACGCAATGCTTTGGTGAAGCAATATCAAAAG
CTATTGCGGATGGATCGGGTAGAGCTGGAGTTTCAGCCTGATGCGATTCGCGCCATTGCTCAGGAAGCCTATCGACGCAGGACGGGAGCC
AGGGCTCTGCGGGCTATTGTCGAAGAGATTATGCTGGATGTGATGTATGAGCTACCGTCCCAATCTCGTAAAGAGCTGACCCAATGCCTG
ATTACTCGCTCGATGGTGGAACAGCGGTCGACGGCTGAGTTGTTGGTGCATCCTTCCGCCATCTCGACCCCAGAATCTGCATAA

Gene Information
Molecule Type genomic DNA
Bases 1344 Bases
Molecular Weight416692.28 Da
Coding Sequence CP000828.1:3479867..3481210
NCBI ReferenceABW28444
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Zf_C4 7 to 46 40 C4_type Zinc finger domain PF06689
NBD_2 132 to 332 201 Nucleotide binding domain 2 PF07724
Clp_C 338 to 430 93 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpX_ACMA1

Accession Number

HSP100_0004

Added on

2012-02-02

Updated On

2014-01-20