Help  Custom Search
 
ATP-dependent protease, ATP-binding subunit ClpC of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

ATP-dependent protease, ATP-binding subunit ClpC

Synonymous Names

B0CEJ8_ACAM1, Caseinolytic peptidase C, ClpC.

Gene names

Gene Name

clpC

Gene Locus Tag

AM1_1947

Gene Identifier

5680762

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class I Clp Proteins
(ClpC-Caseinolytic peptidase C)

SEQUENCE INFORMATION

Sequence
MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDARVEVEKIIGRG SGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLAKVRTQVIR MLGETAEVSAGGGQGRTKTPTLDEFGANLTNLASEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIGEPG VGKTAIAEGLAQRIANGDIPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEIRQASNVILVIDEV HTLIGAGAAEGAIDAANILKPALARGELQCIGATTLDEYRKHIERDAALERRFQPVMVGEPSVEETIEIL YGLRERYEQHHKLSILDESLEAAAKLSDRYISDRYLPDKAIDLIDEAGSRVRLINSQLPPAAKELDKELR KVLKDKDDAVRSQDFDKAGELRDREMEIKSEIKAIAQNKKSSEENKDDSPKVTEEDIAHIVASWTGVPVS KLTESESEKLLHMEDTLHQRLIGQDEAVRAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKTELTKALA TYFFGSEEAMIRLDMSEYMERHTVSKLIGSPPGYVGYNEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNM LLQILEDGRLTDAKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFEFAEDEADSQYNRIRSLVNEELKGY FRPEFLNRLDEIIVFRQLTKDEVKEISELLLKEVFSRLEEKSITLNITDRFKERLVEEGYNPSYGARPLR RAIMRLLEDTLAEEILSGRVKEGDTAIVDVDEDQQVKIASAEKRELLPQAAE

FASTA Format Composition Secondary Structure

Nucleotide
 ATGTTTGAACGCTTTACAGAAAAAGCCATTAAAGTCATCATGCTGGCTCAAGAGGAAGCCCGCCGCTTGGGGCACAATTTTGTCGGCAC
AGAGCAAATTCTTTTGGGGCTCATTGGAGAAGGAACTGGCGTTGCCGCCAAAGTTTTGAAATCCATGGGGGTTAACCTTAAAGATGCTCG
CGTTGAAGTAGAAAAAATTATCGGTCGCGGTTCTGGATTTGTTGCGGTAGAGATTCCCTTTACCCCCAGAGCCAAGCGCGTTCTCGAGTT
GTCGTTAGAAGAGGCCCGTCAGCTGGGTCACAACTACATTGGCACGGAGCACTTGCTGTTAGGACTCATCCGTGAGGGTGAAGGGGTCGC
CGCCCGTGTTCTAGAAAATCTTGGAGTTGACCTGGCTAAGGTACGCACCCAAGTCATCCGCATGTTGGGTGAAACAGCAGAAGTCTCTGC
TGGCGGTGGTCAAGGACGTACTAAGACCCCAACCTTAGATGAGTTTGGCGCCAACCTGACCAACCTTGCCTCTGAAGGCAAGCTAGACCC
CGTTGTGGGACGCCAAAAAGAAATTGAGCGGGTGATTCAGATTCTCGGTCGTCGGACGAAGAACAATCCAGTCTTGATTGGTGAACCGGG
CGTGGGTAAAACTGCGATCGCAGAAGGTCTCGCCCAGCGGATCGCCAATGGAGATATCCCCGACATCCTAGAAGAGAAGCGCGTGGTCAC
CTTGGATATTGGTCTGCTGGTTGCCGGTACCAAATATCGAGGGGAATTCGAAGAGCGTCTCAAGAAAATCATGGATGAGATTCGCCAAGC
CTCCAACGTGATTTTGGTGATTGACGAAGTTCATACCCTGATTGGTGCAGGGGCTGCTGAAGGGGCTATTGATGCTGCGAATATCCTCAA
GCCTGCGTTGGCTCGGGGTGAACTCCAGTGCATCGGTGCCACCACTTTAGATGAGTATCGCAAGCATATCGAGCGAGATGCCGCCCTGGA
ACGTCGTTTCCAGCCGGTGATGGTGGGTGAGCCTTCTGTGGAAGAAACCATCGAAATTCTTTACGGCTTGCGCGAGCGCTATGAGCAGCA
CCATAAACTCAGCATTTTGGATGAGTCTTTAGAAGCGGCAGCCAAGCTTTCGGATCGCTATATCTCCGACCGCTATCTGCCTGACAAGGC
CATTGACCTGATTGATGAAGCTGGTTCTAGAGTTCGGTTAATTAACTCTCAACTTCCCCCAGCAGCCAAAGAATTGGACAAGGAACTACG
CAAAGTTCTTAAAGATAAGGATGATGCCGTTCGCTCCCAAGACTTTGACAAAGCCGGTGAACTGCGCGACCGCGAGATGGAAATCAAATC
CGAGATCAAAGCGATCGCTCAGAACAAAAAGTCGAGCGAGGAGAACAAGGACGATTCCCCCAAGGTGACGGAAGAGGATATTGCCCATAT
TGTGGCTTCCTGGACCGGGGTTCCCGTCAGCAAGCTGACGGAATCTGAGTCTGAGAAGCTGCTGCATATGGAAGATACCCTACACCAGCG
ATTGATCGGTCAGGATGAAGCGGTTCGTGCCATCTCTCGAGCGATTCGCCGGGCCCGTGTGGGTCTCAAGAATCCTAACCGTCCGATTGC
TAGCTTTATTTTCTCTGGTCCAACTGGAGTCGGTAAGACTGAGCTGACCAAGGCTCTGGCCACTTACTTCTTTGGCTCCGAAGAAGCCAT
GATTCGCTTGGATATGTCCGAGTATATGGAGCGACACACGGTCTCCAAGTTGATTGGCTCGCCGCCTGGCTACGTGGGCTATAACGAAGG
CGGTCAGCTAACCGAGGCAGTTCGTCGACGTCCTTACACTGTGGTCCTCTTCGACGAAATCGAAAAGGCTCACCCCGACGTCTTCAATAT
GCTGCTGCAAATTCTGGAAGATGGTCGCTTAACCGACGCCAAAGGACGAACCGTCGACTTCAAGAACACCCTGTTGATCATGACCTCAAA
TATTGGGTCGAAGGTGATTGAAAAGGGTGGCGGCGGCCTCGGCTTTGAATTTGCTGAGGACGAAGCGGATTCTCAATACAATCGCATCCG
CTCCTTGGTCAACGAAGAGCTGAAGGGCTATTTCCGACCGGAATTCTTAAACCGACTCGACGAAATCATCGTCTTCCGTCAGCTCACTAA
GGATGAAGTGAAGGAAATTTCCGAACTATTACTGAAGGAAGTCTTCAGTCGTTTGGAAGAGAAAAGCATCACCTTGAATATCACTGATCG
CTTTAAGGAGCGATTGGTGGAAGAGGGCTACAATCCCAGTTATGGGGCTCGTCCCTTACGTCGAGCCATTATGCGTCTGCTCGAGGACAC
CTTGGCCGAAGAGATTCTCTCTGGTCGGGTGAAGGAAGGCGACACGGCCATTGTTGATGTAGACGAAGATCAGCAAGTTAAGATTGCCTC
GGCTGAAAAACGGGAACTGCTGCCGCAAGCTGCAGAGTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine62726 %
Guanine68128 %
Thyamine57124 %
Cytosine59024 %
A+T119849 %
G+C127152 %

Total Bases :   2469 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA19023
TCTCTC156123
ACACAC174223
TGCTGCTGC188833
GGCGGCGGC200733
TCTCTC235423

Microsatellite Map

ATGTTTGAACGCTTTACAGAAAAAGCCATTAAAGTCATCATGCTGGCTCAAGAGGAAGCCCGCCGCTTGGGGCACAATTTTGTCGGCACA
GAGCAAATTCTTTTGGGGCTCATTGGAGAAGGAACTGGCGTTGCCGCCAAAGTTTTGAAATCCATGGGGGTTAACCTTAAAGATGCTCGC
GTTGAAGTAGAAAAAATTATCGGTCGCGGTTCTGGATTTGTTGCGGTAGAGATTCCCTTTACCCCCAGAGCCAAGCGCGTTCTCGAGTTG
TCGTTAGAAGAGGCCCGTCAGCTGGGTCACAACTACATTGGCACGGAGCACTTGCTGTTAGGACTCATCCGTGAGGGTGAAGGGGTCGCC
GCCCGTGTTCTAGAAAATCTTGGAGTTGACCTGGCTAAGGTACGCACCCAAGTCATCCGCATGTTGGGTGAAACAGCAGAAGTCTCTGCT
GGCGGTGGTCAAGGACGTACTAAGACCCCAACCTTAGATGAGTTTGGCGCCAACCTGACCAACCTTGCCTCTGAAGGCAAGCTAGACCCC
GTTGTGGGACGCCAAAAAGAAATTGAGCGGGTGATTCAGATTCTCGGTCGTCGGACGAAGAACAATCCAGTCTTGATTGGTGAACCGGGC
GTGGGTAAAACTGCGATCGCAGAAGGTCTCGCCCAGCGGATCGCCAATGGAGATATCCCCGACATCCTAGAAGAGAAGCGCGTGGTCACC
TTGGATATTGGTCTGCTGGTTGCCGGTACCAAATATCGAGGGGAATTCGAAGAGCGTCTCAAGAAAATCATGGATGAGATTCGCCAAGCC
TCCAACGTGATTTTGGTGATTGACGAAGTTCATACCCTGATTGGTGCAGGGGCTGCTGAAGGGGCTATTGATGCTGCGAATATCCTCAAG
CCTGCGTTGGCTCGGGGTGAACTCCAGTGCATCGGTGCCACCACTTTAGATGAGTATCGCAAGCATATCGAGCGAGATGCCGCCCTGGAA
CGTCGTTTCCAGCCGGTGATGGTGGGTGAGCCTTCTGTGGAAGAAACCATCGAAATTCTTTACGGCTTGCGCGAGCGCTATGAGCAGCAC
CATAAACTCAGCATTTTGGATGAGTCTTTAGAAGCGGCAGCCAAGCTTTCGGATCGCTATATCTCCGACCGCTATCTGCCTGACAAGGCC
ATTGACCTGATTGATGAAGCTGGTTCTAGAGTTCGGTTAATTAACTCTCAACTTCCCCCAGCAGCCAAAGAATTGGACAAGGAACTACGC
AAAGTTCTTAAAGATAAGGATGATGCCGTTCGCTCCCAAGACTTTGACAAAGCCGGTGAACTGCGCGACCGCGAGATGGAAATCAAATCC
GAGATCAAAGCGATCGCTCAGAACAAAAAGTCGAGCGAGGAGAACAAGGACGATTCCCCCAAGGTGACGGAAGAGGATATTGCCCATATT
GTGGCTTCCTGGACCGGGGTTCCCGTCAGCAAGCTGACGGAATCTGAGTCTGAGAAGCTGCTGCATATGGAAGATACCCTACACCAGCGA
TTGATCGGTCAGGATGAAGCGGTTCGTGCCATCTCTCGAGCGATTCGCCGGGCCCGTGTGGGTCTCAAGAATCCTAACCGTCCGATTGCT
AGCTTTATTTTCTCTGGTCCAACTGGAGTCGGTAAGACTGAGCTGACCAAGGCTCTGGCCACTTACTTCTTTGGCTCCGAAGAAGCCATG
ATTCGCTTGGATATGTCCGAGTATATGGAGCGACACACGGTCTCCAAGTTGATTGGCTCGCCGCCTGGCTACGTGGGCTATAACGAAGGC
GGTCAGCTAACCGAGGCAGTTCGTCGACGTCCTTACACTGTGGTCCTCTTCGACGAAATCGAAAAGGCTCACCCCGACGTCTTCAATATG
CTGCTGCAAATTCTGGAAGATGGTCGCTTAACCGACGCCAAAGGACGAACCGTCGACTTCAAGAACACCCTGTTGATCATGACCTCAAAT
ATTGGGTCGAAGGTGATTGAAAAGGGTGGCGGCGGCCTCGGCTTTGAATTTGCTGAGGACGAAGCGGATTCTCAATACAATCGCATCCGC
TCCTTGGTCAACGAAGAGCTGAAGGGCTATTTCCGACCGGAATTCTTAAACCGACTCGACGAAATCATCGTCTTCCGTCAGCTCACTAAG
GATGAAGTGAAGGAAATTTCCGAACTATTACTGAAGGAAGTCTTCAGTCGTTTGGAAGAGAAAAGCATCACCTTGAATATCACTGATCGC
TTTAAGGAGCGATTGGTGGAAGAGGGCTACAATCCCAGTTATGGGGCTCGTCCCTTACGTCGAGCCATTATGCGTCTGCTCGAGGACACC
TTGGCCGAAGAGATTCTCTCTGGTCGGGTGAAGGAAGGCGACACGGCCATTGTTGATGTAGACGAAGATCAGCAAGTTAAGATTGCCTCG
GCTGAAAAACGGGAACTGCTGCCGCAAGCTGCAGAGTAA

Gene Information
Molecule Type genomic DNA
Bases 2469 Bases
Molecular Weight764827.12 Da
Coding Sequence CP000828.1:1941548..1944016
NCBI ReferenceABW26964
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N Domain 16 to 68 53 Clp amino terminal domain PF02861
N Domain 91 to 143 53 Clp amino terminal domain PF02861
NBD_1 203 to 338 136 Nucleotide binding domain 1 PF00004
UVR 416 to 451 36 UvrB/UvrC motif PF02151
NBD_2 537 to 712 176 Nucleotide binding domain 2 PF07724
Clp_C 718 to 808 89 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpC_ACMA1

Accession Number

HSP100_0003

Added on

2012-02-02

Updated On

2014-01-20