Help  Custom Search
 
chaperone ClpB of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperone ClpB

Synonymous Names

B0BZT0_ACAM1, Caseinolytic peptidase B, ClpB.

Gene names

Gene Name

clpB

Gene Locus Tag

AM1_2125

Gene Identifier

5680939

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class I Clp Proteins
(ClpB-Caseinolytic peptidase B)

SEQUENCE INFORMATION

Sequence
MQPTNHDQFTEKAWAAIVRTSDLAKEAQQQQIESEHLLQALVEDDGLAGQIFTKAGTDVQRVRDRTTEFI NRQAKLTTPSESVYLGRSLDTLFDRAENFRRSLGDDFISIEHLVLGYIEDDRFGQPLLQGLGITEQMLKQ AVTDIRGNHKVTDKNPEGKYESLEKYGRDLTALAREGKLDPVIGRDDEIRRTIQILSRRTKNNPVLIGEP GVGKTAIAEGLAQRIVARDVPESLRDRKLIALDMGSLIAGAKYRGEFEERLKSVLKEVTESDGLMILFID EIHTVVGAGASQGAMDAGNLLKPMLARGELRCIGATTLDEYRKYIEKDAALERRFQQVYIDQPNIQDTVS ILRGLKERYEVHHGVKISDNALVAAATLSTRYISDRFLPDKAIDLMDEAAAKLKMEITSKPEELDEIDRK ILQLEMERLSLEKESDRASLERLERIEQEIANLQEDQKTLNAQWQSEKQIIDDIQTIKEEIDRVNIEIQQ AERNYDLNHAAELKYGKLTNLQRQLESAETQLAQRQTNTNSLLREEVTDADIAEIISKWTGIPVSKLVAS EMEKLLHLEDELHQRVIGQEEAVTAVSDAIQRSRAGLADPNRPIASFIFLGPTGVGKTELGKALAAYLFD TEDAMVRIDMSEYMEKHTVARMIGAPPGYVGYDEGGQLTEAVRRRPYAVILFDEIEKAHPDVFNIMLQIL DDGRVTDSQGRTVDFKNAVIIMTSNIGSQHILDLAGDDSRYSEMQNRVMDAMRSHFRPEFLNRIDELIIF RSLRKDQLRRITQLQVQRLAKRLSDRKMSLKLSESALDFLAEVGYDPVYGARPLKRAIQRELETQIAKAI LRGDFGEGDTIFADVENERLIFKRMGAEVLTTSGS

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCAACCCACCAATCATGACCAATTTACGGAAAAAGCTTGGGCTGCGATTGTACGAACCTCTGACTTGGCGAAAGAGGCCCAGCAACA
GCAGATTGAGAGTGAACATCTGCTGCAAGCCCTGGTTGAAGACGATGGTTTAGCAGGACAAATTTTTACTAAAGCCGGGACAGATGTGCA
GCGCGTCCGCGATCGCACCACGGAATTTATCAATCGGCAAGCGAAACTCACCACACCGAGTGAGTCAGTTTATCTAGGTCGCAGCCTAGA
CACCCTCTTTGATCGGGCCGAAAACTTCCGCCGCTCGCTTGGGGATGATTTTATTTCCATTGAGCACTTGGTCTTGGGCTATATCGAAGA
TGATCGCTTCGGCCAACCCCTCCTCCAAGGTCTGGGCATCACCGAGCAAATGTTGAAGCAAGCTGTTACAGACATCCGGGGAAATCATAA
AGTCACGGATAAGAATCCAGAAGGCAAGTATGAGTCCTTAGAGAAATATGGTCGTGACCTAACAGCGCTGGCTCGGGAAGGAAAGTTGGA
CCCGGTGATTGGCCGAGATGACGAGATCCGCAGAACGATTCAAATCCTCTCCCGACGCACGAAGAATAACCCCGTCTTGATTGGGGAACC
TGGGGTGGGTAAAACAGCCATTGCCGAAGGGTTAGCCCAGCGAATTGTGGCCCGAGATGTCCCGGAATCTTTGCGAGATCGCAAACTGAT
TGCCCTTGACATGGGATCCCTGATTGCCGGGGCCAAATATCGGGGAGAATTCGAGGAACGACTCAAGTCTGTCCTTAAGGAAGTGACGGA
GTCAGACGGGTTGATGATCTTATTTATTGATGAGATCCATACCGTCGTTGGCGCAGGGGCCAGTCAAGGTGCCATGGATGCGGGCAACTT
GTTAAAGCCCATGCTGGCCCGAGGGGAATTGCGCTGTATTGGAGCCACCACCCTCGATGAATATCGCAAATATATTGAAAAAGATGCGGC
CCTAGAGCGACGCTTTCAGCAGGTCTATATTGATCAACCCAATATTCAAGACACCGTCTCAATTTTGCGGGGTCTAAAAGAACGGTATGA
GGTCCATCACGGGGTCAAGATTTCTGATAACGCCCTGGTTGCCGCCGCCACTCTTTCTACCCGCTACATCAGCGACCGCTTTTTACCTGA
CAAGGCTATTGACCTAATGGATGAAGCGGCAGCCAAGCTCAAAATGGAAATTACCTCTAAGCCGGAAGAGCTAGACGAAATTGATCGTAA
AATCCTCCAGCTGGAAATGGAGCGTTTATCCCTTGAAAAGGAAAGCGATCGCGCTTCTCTAGAACGCCTCGAACGAATCGAGCAGGAGAT
TGCCAACCTACAAGAAGATCAAAAGACCCTGAATGCCCAATGGCAGTCTGAGAAACAAATTATTGATGATATCCAAACCATCAAAGAAGA
AATTGATCGGGTCAATATTGAGATTCAGCAGGCTGAGCGCAACTATGATCTCAACCATGCAGCTGAACTGAAATATGGCAAACTCACTAA
TTTGCAGCGGCAGCTAGAATCGGCTGAAACTCAGCTAGCCCAGCGCCAAACCAATACCAACTCCCTTTTAAGAGAAGAGGTAACCGATGC
TGATATTGCCGAAATCATCTCTAAATGGACGGGGATTCCCGTCAGTAAGCTGGTGGCGTCGGAAATGGAAAAGCTGCTGCACCTAGAAGA
TGAGCTACATCAGCGAGTGATTGGCCAGGAAGAAGCAGTGACGGCCGTGTCTGATGCGATTCAGCGATCGCGTGCCGGTCTCGCAGATCC
CAACCGCCCCATTGCCAGCTTTATCTTCTTAGGTCCAACGGGTGTGGGCAAAACAGAACTAGGCAAAGCTTTAGCCGCCTACCTATTTGA
TACCGAAGATGCCATGGTCCGTATCGACATGTCGGAATATATGGAGAAGCATACGGTGGCCCGGATGATTGGGGCCCCTCCCGGCTATGT
CGGCTATGACGAAGGGGGGCAACTGACTGAAGCCGTTCGTCGCCGTCCCTATGCGGTCATCCTCTTTGATGAAATTGAGAAGGCCCATCC
CGATGTCTTCAATATCATGCTGCAAATTCTGGATGATGGCCGAGTCACGGATTCCCAAGGTCGCACTGTCGACTTTAAGAATGCGGTGAT
TATTATGACCAGTAATATTGGCTCCCAACATATTTTAGATTTGGCGGGAGATGACAGCCGCTACAGCGAAATGCAAAATCGGGTTATGGA
TGCCATGCGCTCCCACTTCCGACCTGAATTTCTGAACCGGATTGATGAGCTGATTATCTTCCGTAGTCTGCGTAAGGATCAGTTGCGCCG
AATTACTCAACTCCAGGTTCAACGACTGGCGAAACGACTCAGCGATCGCAAGATGTCTCTCAAACTCTCAGAATCAGCGTTAGATTTCCT
AGCAGAAGTTGGATACGACCCGGTCTATGGGGCCAGACCGCTGAAACGGGCCATTCAGCGGGAGCTAGAAACCCAAATTGCCAAGGCCAT
TTTGCGAGGTGACTTTGGTGAAGGAGACACCATTTTTGCGGATGTCGAGAATGAGCGGTTGATCTTTAAGCGCATGGGGGCAGAAGTCTT
GACCACTTCGGGTTCATAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine71828 %
Guanine68427 %
Thyamine59023 %
Cytosine63625 %
A+T130850 %
G+C132051 %

Total Bases :   2628 bases

Microsatellites
SequencePosition LengthRepeats
ATATAT96823
GCCGCCGCC111933
ATATAT192523
GGGGGG199223
TCTCTC239423

Microsatellite Map

ATGCAACCCACCAATCATGACCAATTTACGGAAAAAGCTTGGGCTGCGATTGTACGAACCTCTGACTTGGCGAAAGAGGCCCAGCAACAG
CAGATTGAGAGTGAACATCTGCTGCAAGCCCTGGTTGAAGACGATGGTTTAGCAGGACAAATTTTTACTAAAGCCGGGACAGATGTGCAG
CGCGTCCGCGATCGCACCACGGAATTTATCAATCGGCAAGCGAAACTCACCACACCGAGTGAGTCAGTTTATCTAGGTCGCAGCCTAGAC
ACCCTCTTTGATCGGGCCGAAAACTTCCGCCGCTCGCTTGGGGATGATTTTATTTCCATTGAGCACTTGGTCTTGGGCTATATCGAAGAT
GATCGCTTCGGCCAACCCCTCCTCCAAGGTCTGGGCATCACCGAGCAAATGTTGAAGCAAGCTGTTACAGACATCCGGGGAAATCATAAA
GTCACGGATAAGAATCCAGAAGGCAAGTATGAGTCCTTAGAGAAATATGGTCGTGACCTAACAGCGCTGGCTCGGGAAGGAAAGTTGGAC
CCGGTGATTGGCCGAGATGACGAGATCCGCAGAACGATTCAAATCCTCTCCCGACGCACGAAGAATAACCCCGTCTTGATTGGGGAACCT
GGGGTGGGTAAAACAGCCATTGCCGAAGGGTTAGCCCAGCGAATTGTGGCCCGAGATGTCCCGGAATCTTTGCGAGATCGCAAACTGATT
GCCCTTGACATGGGATCCCTGATTGCCGGGGCCAAATATCGGGGAGAATTCGAGGAACGACTCAAGTCTGTCCTTAAGGAAGTGACGGAG
TCAGACGGGTTGATGATCTTATTTATTGATGAGATCCATACCGTCGTTGGCGCAGGGGCCAGTCAAGGTGCCATGGATGCGGGCAACTTG
TTAAAGCCCATGCTGGCCCGAGGGGAATTGCGCTGTATTGGAGCCACCACCCTCGATGAATATCGCAAATATATTGAAAAAGATGCGGCC
CTAGAGCGACGCTTTCAGCAGGTCTATATTGATCAACCCAATATTCAAGACACCGTCTCAATTTTGCGGGGTCTAAAAGAACGGTATGAG
GTCCATCACGGGGTCAAGATTTCTGATAACGCCCTGGTTGCCGCCGCCACTCTTTCTACCCGCTACATCAGCGACCGCTTTTTACCTGAC
AAGGCTATTGACCTAATGGATGAAGCGGCAGCCAAGCTCAAAATGGAAATTACCTCTAAGCCGGAAGAGCTAGACGAAATTGATCGTAAA
ATCCTCCAGCTGGAAATGGAGCGTTTATCCCTTGAAAAGGAAAGCGATCGCGCTTCTCTAGAACGCCTCGAACGAATCGAGCAGGAGATT
GCCAACCTACAAGAAGATCAAAAGACCCTGAATGCCCAATGGCAGTCTGAGAAACAAATTATTGATGATATCCAAACCATCAAAGAAGAA
ATTGATCGGGTCAATATTGAGATTCAGCAGGCTGAGCGCAACTATGATCTCAACCATGCAGCTGAACTGAAATATGGCAAACTCACTAAT
TTGCAGCGGCAGCTAGAATCGGCTGAAACTCAGCTAGCCCAGCGCCAAACCAATACCAACTCCCTTTTAAGAGAAGAGGTAACCGATGCT
GATATTGCCGAAATCATCTCTAAATGGACGGGGATTCCCGTCAGTAAGCTGGTGGCGTCGGAAATGGAAAAGCTGCTGCACCTAGAAGAT
GAGCTACATCAGCGAGTGATTGGCCAGGAAGAAGCAGTGACGGCCGTGTCTGATGCGATTCAGCGATCGCGTGCCGGTCTCGCAGATCCC
AACCGCCCCATTGCCAGCTTTATCTTCTTAGGTCCAACGGGTGTGGGCAAAACAGAACTAGGCAAAGCTTTAGCCGCCTACCTATTTGAT
ACCGAAGATGCCATGGTCCGTATCGACATGTCGGAATATATGGAGAAGCATACGGTGGCCCGGATGATTGGGGCCCCTCCCGGCTATGTC
GGCTATGACGAAGGGGGGCAACTGACTGAAGCCGTTCGTCGCCGTCCCTATGCGGTCATCCTCTTTGATGAAATTGAGAAGGCCCATCCC
GATGTCTTCAATATCATGCTGCAAATTCTGGATGATGGCCGAGTCACGGATTCCCAAGGTCGCACTGTCGACTTTAAGAATGCGGTGATT
ATTATGACCAGTAATATTGGCTCCCAACATATTTTAGATTTGGCGGGAGATGACAGCCGCTACAGCGAAATGCAAAATCGGGTTATGGAT
GCCATGCGCTCCCACTTCCGACCTGAATTTCTGAACCGGATTGATGAGCTGATTATCTTCCGTAGTCTGCGTAAGGATCAGTTGCGCCGA
ATTACTCAACTCCAGGTTCAACGACTGGCGAAACGACTCAGCGATCGCAAGATGTCTCTCAAACTCTCAGAATCAGCGTTAGATTTCCTA
GCAGAAGTTGGATACGACCCGGTCTATGGGGCCAGACCGCTGAAACGGGCCATTCAGCGGGAGCTAGAAACCCAAATTGCCAAGGCCATT
TTGCGAGGTGACTTTGGTGAAGGAGACACCATTTTTGCGGATGTCGAGAATGAGCGGTTGATCTTTAAGCGCATGGGGGCAGAAGTCTTG
ACCACTTCGGGTTCATAG

Gene Information
Molecule Type genomic DNA
Bases 2628 Bases
Molecular Weight813398.94 Da
Coding Sequence CP000828.1:2114793..2117420
NCBI ReferenceABW27140
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N Domain 20 to 71 52 Clp amino terminal domain PF02861
N Domain 96 to 147 52 Clp amino terminal domain PF02861
NBD_1 204 to 341 138 Nucleotide binding domain 1 PF00004
M Domain 412 to 535 124 Coiled coil Middle domain Manually identified
NBD_2 602 to 767 166 Nucleotide binding domain 2 PF07724
Clp_C 773 to 862 90 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpB_ACMA2

Accession Number

HSP100_0002

Added on

2012-02-02

Updated On

2014-01-20