Help  Custom Search
 
chaperone ClpB of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperone ClpB

Synonymous Names

B0CAW9_ACAM1, Caseinolytic peptidase B protein, ClpB.

Gene names

Gene Name

clpB

Gene Locus Tag

AM1_0402

Gene Identifier

5679233

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class I Clp Proteins
(ClpB-Caseinolytic peptidase B)

SEQUENCE INFORMATION

Sequence
MQPTDPDKFTDKVWTAIVKSQDVARRFSNNKLEVEHLTISLLEEEPLANKILNKAKVDFEQILQQLTAFA ERQTKVAEGTALFLGPGLDRLLDQADALRQDRGDQFISVDHYLLAFAEDARVGQSLLRDQGIARTDLEKA IKAMRGTQKVADQESESRYNALEKYGRDLTERAKAGKLDPVIGRDDEIRRVIQVLSRRLKNNPVLIGEPG VGKTAIAEGLAQRIVNGDVPESLKNRQLITLDMGSLIAGAKYRGEFEDRLKAVLREVTHSDGQIVLFIDE LHTVVGAGSGQSSMDASNLLKPMLSRGELRCIGATTLDEYRKHIEKDAALERRFQQVYIDQPTVDSAISI LRGLKDRYEIHHNVKITDSALVAAAVLSDRYIADRFLPDKAIDLVDEAAAKLKMEMTSKPSELEGIERRV MQLEMEKMSLEQEQKRSSIGGIYESSEDHLQRVMAEIEELLPKRESLEEQWKTEKQVLEEINSLKEQEAQ VRVEIEKAEREFDHEKAVQLTYSRMATLQQELEEHEAKLLAIRAQGPTLLREEVTEEDVAEVVANWTGIP VSRLLESERQKLLQLEDHLHERVIGQEDAVEAVSAAIRRARAGMKDPNRPIGSFMFLGPTGVGKTELARA LAQFLFDTEDAIIRIDMSEYMEKHAVSRLVGASPGYVGYEEGGQLSEMVRRRPYSVVLLDEVEKAHPEIF NILLQVLDDGRITDAQGRTVNFCNTIIVLTSNIGSEHITEATEEEEQYLEMQMKVLEALRSHFRPEFLNR IDEITMFHTLNREQLGSIVKIQLKRIEALLAEQKLAIQLSDEALEHIVEAGYDPVYGARPLKRALQRELE NPIATKILENTFTSGDTIMVDWDEDELIFSEAPRATLDMAEAEESEEEESEEEELAPAAS

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCAACCTACTGATCCTGATAAGTTTACTGATAAGGTATGGACGGCGATTGTTAAGTCTCAAGATGTAGCGCGACGGTTTAGTAATAA
CAAACTAGAGGTTGAGCATTTAACTATTTCTCTATTAGAGGAAGAGCCATTAGCCAATAAGATTTTAAACAAGGCTAAAGTTGATTTTGA
GCAGATTTTGCAACAGCTAACGGCCTTTGCTGAGCGACAGACTAAGGTTGCCGAAGGAACGGCGTTGTTCTTAGGTCCAGGCTTGGACCG
TCTTCTTGATCAGGCAGATGCCCTACGGCAGGATCGAGGCGATCAGTTTATTTCCGTTGACCACTATTTATTGGCCTTTGCTGAAGATGC
TCGGGTGGGGCAGTCTCTGCTGCGAGACCAGGGAATTGCCCGTACCGATCTGGAAAAAGCCATCAAGGCGATGCGGGGCACCCAAAAGGT
GGCGGATCAAGAGTCGGAGTCTCGCTATAATGCCCTGGAAAAGTATGGTCGCGATCTAACGGAGCGAGCCAAGGCCGGAAAGCTAGATCC
GGTGATTGGTCGGGATGATGAGATTCGGCGAGTGATTCAGGTTTTGTCTCGACGGTTAAAGAATAATCCTGTTTTGATTGGCGAACCGGG
GGTGGGGAAGACTGCGATCGCAGAAGGTCTCGCTCAGCGTATCGTGAATGGCGATGTGCCAGAATCCTTGAAAAATCGGCAGTTGATTAC
CCTAGATATGGGCAGCTTAATTGCCGGTGCCAAGTATCGTGGTGAGTTTGAAGATCGCCTCAAGGCGGTCTTGCGGGAAGTCACCCATTC
CGATGGTCAGATTGTTCTATTTATTGATGAACTCCATACCGTTGTGGGAGCAGGGTCAGGCCAAAGCTCCATGGATGCCAGCAATTTACT
TAAGCCGATGCTGTCACGAGGGGAATTACGCTGTATTGGAGCAACCACTCTTGATGAATATCGCAAGCATATTGAAAAAGATGCGGCTTT
AGAGCGACGGTTTCAGCAGGTTTATATTGATCAACCGACGGTTGATTCTGCTATTTCAATCCTGCGAGGGTTGAAAGATCGATACGAAAT
TCACCATAACGTCAAAATTACTGACTCCGCTTTAGTCGCAGCAGCCGTTCTTTCAGATCGCTATATTGCCGATCGGTTTCTGCCCGATAA
GGCCATCGATCTAGTGGATGAAGCGGCGGCTAAGCTGAAGATGGAGATGACCTCAAAACCCAGCGAACTAGAGGGAATTGAGCGGCGAGT
CATGCAGCTAGAGATGGAAAAGATGTCTCTAGAACAGGAGCAAAAACGCTCCAGTATTGGCGGCATTTATGAGTCTTCGGAAGATCATTT
GCAGCGGGTGATGGCAGAGATTGAAGAGCTATTGCCCAAGCGTGAGTCTTTGGAAGAACAATGGAAGACGGAAAAACAGGTTTTAGAGGA
AATCAATAGCCTCAAAGAACAAGAAGCCCAGGTTCGGGTTGAGATTGAAAAAGCAGAGCGAGAGTTTGACCACGAAAAAGCCGTCCAGCT
CACCTATAGCCGTATGGCCACATTGCAGCAGGAATTGGAAGAGCATGAAGCCAAACTATTGGCGATTCGAGCCCAGGGCCCCACTCTTCT
AAGAGAAGAAGTGACGGAAGAAGATGTTGCCGAGGTCGTCGCCAACTGGACGGGGATTCCAGTGAGTCGGCTGCTGGAGTCAGAACGTCA
GAAGCTGTTGCAATTAGAAGATCATTTGCATGAACGGGTCATTGGCCAGGAAGATGCCGTGGAAGCGGTATCGGCGGCTATCCGTCGAGC
CAGAGCGGGGATGAAAGACCCGAATCGACCGATTGGTTCCTTTATGTTTTTGGGGCCAACCGGGGTGGGTAAAACCGAGCTGGCTCGGGC
TTTAGCCCAGTTTCTGTTTGACACGGAAGACGCCATTATTCGGATTGATATGTCTGAATATATGGAAAAGCACGCTGTATCCCGGCTGGT
AGGTGCTTCTCCGGGCTATGTGGGCTATGAAGAAGGGGGACAGCTTTCGGAAATGGTGCGGCGACGTCCCTATTCGGTGGTGCTGTTGGA
TGAAGTGGAGAAGGCCCACCCAGAGATCTTTAATATTCTGCTGCAGGTGCTGGACGATGGCCGAATCACGGATGCTCAGGGACGGACCGT
CAATTTCTGCAATACGATTATCGTCTTAACTAGCAATATTGGCAGTGAGCATATTACGGAGGCGACGGAGGAAGAGGAACAATACCTAGA
GATGCAGATGAAAGTGTTGGAGGCGTTGCGATCGCACTTTCGTCCCGAGTTTCTCAACCGTATCGATGAAATCACCATGTTCCATACTCT
CAATCGTGAGCAGCTTGGATCGATTGTCAAGATTCAGTTGAAGCGAATTGAAGCATTGTTAGCGGAACAGAAGTTGGCCATTCAGCTTTC
CGATGAAGCATTAGAACATATTGTGGAAGCCGGGTATGACCCGGTTTATGGTGCTCGTCCCTTGAAGCGGGCCTTGCAGCGAGAACTTGA
AAATCCCATTGCCACCAAAATTTTGGAAAATACGTTTACTAGTGGCGACACGATTATGGTGGACTGGGATGAGGATGAGCTGATCTTTTC
TGAAGCTCCGCGGGCGACTTTGGACATGGCGGAAGCAGAAGAGTCTGAAGAAGAGGAGTCTGAAGAGGAAGAACTAGCTCCAGCAGCGTC
CTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine72327 %
Guanine78129 %
Thyamine64824 %
Cytosine55121 %
A+T137151 %
G+C133250 %

Total Bases :   2703 bases

Microsatellites
SequencePosition LengthRepeats
ATATAT194623

Microsatellite Map

ATGCAACCTACTGATCCTGATAAGTTTACTGATAAGGTATGGACGGCGATTGTTAAGTCTCAAGATGTAGCGCGACGGTTTAGTAATAAC
AAACTAGAGGTTGAGCATTTAACTATTTCTCTATTAGAGGAAGAGCCATTAGCCAATAAGATTTTAAACAAGGCTAAAGTTGATTTTGAG
CAGATTTTGCAACAGCTAACGGCCTTTGCTGAGCGACAGACTAAGGTTGCCGAAGGAACGGCGTTGTTCTTAGGTCCAGGCTTGGACCGT
CTTCTTGATCAGGCAGATGCCCTACGGCAGGATCGAGGCGATCAGTTTATTTCCGTTGACCACTATTTATTGGCCTTTGCTGAAGATGCT
CGGGTGGGGCAGTCTCTGCTGCGAGACCAGGGAATTGCCCGTACCGATCTGGAAAAAGCCATCAAGGCGATGCGGGGCACCCAAAAGGTG
GCGGATCAAGAGTCGGAGTCTCGCTATAATGCCCTGGAAAAGTATGGTCGCGATCTAACGGAGCGAGCCAAGGCCGGAAAGCTAGATCCG
GTGATTGGTCGGGATGATGAGATTCGGCGAGTGATTCAGGTTTTGTCTCGACGGTTAAAGAATAATCCTGTTTTGATTGGCGAACCGGGG
GTGGGGAAGACTGCGATCGCAGAAGGTCTCGCTCAGCGTATCGTGAATGGCGATGTGCCAGAATCCTTGAAAAATCGGCAGTTGATTACC
CTAGATATGGGCAGCTTAATTGCCGGTGCCAAGTATCGTGGTGAGTTTGAAGATCGCCTCAAGGCGGTCTTGCGGGAAGTCACCCATTCC
GATGGTCAGATTGTTCTATTTATTGATGAACTCCATACCGTTGTGGGAGCAGGGTCAGGCCAAAGCTCCATGGATGCCAGCAATTTACTT
AAGCCGATGCTGTCACGAGGGGAATTACGCTGTATTGGAGCAACCACTCTTGATGAATATCGCAAGCATATTGAAAAAGATGCGGCTTTA
GAGCGACGGTTTCAGCAGGTTTATATTGATCAACCGACGGTTGATTCTGCTATTTCAATCCTGCGAGGGTTGAAAGATCGATACGAAATT
CACCATAACGTCAAAATTACTGACTCCGCTTTAGTCGCAGCAGCCGTTCTTTCAGATCGCTATATTGCCGATCGGTTTCTGCCCGATAAG
GCCATCGATCTAGTGGATGAAGCGGCGGCTAAGCTGAAGATGGAGATGACCTCAAAACCCAGCGAACTAGAGGGAATTGAGCGGCGAGTC
ATGCAGCTAGAGATGGAAAAGATGTCTCTAGAACAGGAGCAAAAACGCTCCAGTATTGGCGGCATTTATGAGTCTTCGGAAGATCATTTG
CAGCGGGTGATGGCAGAGATTGAAGAGCTATTGCCCAAGCGTGAGTCTTTGGAAGAACAATGGAAGACGGAAAAACAGGTTTTAGAGGAA
ATCAATAGCCTCAAAGAACAAGAAGCCCAGGTTCGGGTTGAGATTGAAAAAGCAGAGCGAGAGTTTGACCACGAAAAAGCCGTCCAGCTC
ACCTATAGCCGTATGGCCACATTGCAGCAGGAATTGGAAGAGCATGAAGCCAAACTATTGGCGATTCGAGCCCAGGGCCCCACTCTTCTA
AGAGAAGAAGTGACGGAAGAAGATGTTGCCGAGGTCGTCGCCAACTGGACGGGGATTCCAGTGAGTCGGCTGCTGGAGTCAGAACGTCAG
AAGCTGTTGCAATTAGAAGATCATTTGCATGAACGGGTCATTGGCCAGGAAGATGCCGTGGAAGCGGTATCGGCGGCTATCCGTCGAGCC
AGAGCGGGGATGAAAGACCCGAATCGACCGATTGGTTCCTTTATGTTTTTGGGGCCAACCGGGGTGGGTAAAACCGAGCTGGCTCGGGCT
TTAGCCCAGTTTCTGTTTGACACGGAAGACGCCATTATTCGGATTGATATGTCTGAATATATGGAAAAGCACGCTGTATCCCGGCTGGTA
GGTGCTTCTCCGGGCTATGTGGGCTATGAAGAAGGGGGACAGCTTTCGGAAATGGTGCGGCGACGTCCCTATTCGGTGGTGCTGTTGGAT
GAAGTGGAGAAGGCCCACCCAGAGATCTTTAATATTCTGCTGCAGGTGCTGGACGATGGCCGAATCACGGATGCTCAGGGACGGACCGTC
AATTTCTGCAATACGATTATCGTCTTAACTAGCAATATTGGCAGTGAGCATATTACGGAGGCGACGGAGGAAGAGGAACAATACCTAGAG
ATGCAGATGAAAGTGTTGGAGGCGTTGCGATCGCACTTTCGTCCCGAGTTTCTCAACCGTATCGATGAAATCACCATGTTCCATACTCTC
AATCGTGAGCAGCTTGGATCGATTGTCAAGATTCAGTTGAAGCGAATTGAAGCATTGTTAGCGGAACAGAAGTTGGCCATTCAGCTTTCC
GATGAAGCATTAGAACATATTGTGGAAGCCGGGTATGACCCGGTTTATGGTGCTCGTCCCTTGAAGCGGGCCTTGCAGCGAGAACTTGAA
AATCCCATTGCCACCAAAATTTTGGAAAATACGTTTACTAGTGGCGACACGATTATGGTGGACTGGGATGAGGATGAGCTGATCTTTTCT
GAAGCTCCGCGGGCGACTTTGGACATGGCGGAAGCAGAAGAGTCTGAAGAAGAGGAGTCTGAAGAGGAAGAACTAGCTCCAGCAGCGTCC
TAA

Gene Information
Molecule Type genomic DNA
Bases 2703 Bases
Molecular Weight839961.66 Da
Coding Sequence complement(CP000828.1:374623..377325)
NCBI ReferenceABW25459
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N Domain 20 to 71 52 Clp amino terminal domain PF02861
N Domain 95 to 146 52 Clp amino terminal domain PF02861
NBD_1 203 to 340 138 Nucleotide binding domain 1 PF00004
M Domain 411 to 536 126 Coiled coil Middle domain Manually identified
NBD_2 609 to 774 166 Nucleotide binding domain 2 PF07724
Clp_C 780 to 869 90 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpB_ACMA1

Accession Number

HSP100_0001

Added on

2012-02-02

Updated On

2014-01-20